Anti-GPM6A

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59645.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in neuronal differentiation, including differentiation and migration... mehr
Produktinformationen "Anti-GPM6A"
Protein function: Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G- protein-coupled receptors (GPCRs), enhances internalization and recycling of mu-type opioid receptor. [The UniProt Consortium]
Schlagworte: Anti-M6a, Anti-M6A, Anti-GPM6A, Anti-Neuronal membrane glycoprotein M6-a
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59645

Eigenschaften

Anwendung: ICC, IF, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat (Erwartet: mouse, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the C-terminal region of Human GPM6A. (within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN)
MW: 31 kD
Format: Affinity Purified

Datenbank Information

UniProt ID : P51674 | Passende Produkte
Gene ID GeneID 2823 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GPM6A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen