Anti-GM2A

Anti-GM2A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58933.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: The large binding pocket can accommodate several single chain phospholipids and... mehr
Produktinformationen "Anti-GM2A"
Protein function: The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity. Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta- hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. [The UniProt Consortium]
Schlagworte: Anti-GM2A
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58933

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: guinea pig)
Immunogen: Synthetic peptide around the N-terminal region of Human GM2A. (within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL)
MW: 20 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GM2A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen