Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)

Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
127361.50 50 µg - -

3 - 19 Werktage*

699,00 €
 
GLUD2, Glutamate dehydrogenase 2, is important for recycling the chief excitatory... mehr
Produktinformationen "Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)"
GLUD2, Glutamate dehydrogenase 2, is important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission. It is expressed in retina, testis and, at a lower level, brain. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 127361

Eigenschaften

Anwendung: IHC, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen