Anti-GKN1 (Gastrokine 1, AMP18, BRICD1, CA11, FOV, MGC70354, foveolin)

Anti-GKN1 (Gastrokine 1, AMP18, BRICD1, CA11, FOV, MGC70354, foveolin)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
246616.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as... mehr
Produktinformationen "Anti-GKN1 (Gastrokine 1, AMP18, BRICD1, CA11, FOV, MGC70354, foveolin)"
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq, Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 246616

Eigenschaften

Anwendung: ELISA
Antikörper-Typ: Monoclonal
Klon: 1G17
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: GKN1 (AAH59778, 21aa-185aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GKN1 (Gastrokine 1, AMP18, BRICD1, CA11, FOV, MGC70354, foveolin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen