Anti-GJA3 / Connexin 46

Anti-GJA3 / Connexin 46
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58825.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Structural component of lens fiber gap junctions (PubMed:30044662). Gap... mehr
Produktinformationen "Anti-GJA3 / Connexin 46"
Protein function: Structural component of lens fiber gap junctions (PubMed:30044662). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (PubMed:30044662). [The UniProt Consortium]
Schlagworte: Anti-Cx46, Anti-GJA3, Anti-Connexin-46, Anti-Gap junction alpha-3 protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58825

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 89-118 of Human GJA3 (TLIYLGHVLHIVRMEEKKKEREEEEQLKRE)
MW: 47 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GJA3 / Connexin 46"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen