Anti-GADD34 / PPP1R15A

Anti-GADD34 / PPP1R15A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ7101 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit... mehr
Produktinformationen "Anti-GADD34 / PPP1R15A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene. Protein function: Recruits the serine/threonine-protein phosphatase PPP1CA to prevents excessive phosphorylation of the translation initiation factor eIF-2A/EIF2S1, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress (PubMed:26742780, PubMed:26095357). Down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 by PP1 (PubMed:14718519). May promote apoptosis by inducing p53/TP53 phosphorylation on 'Ser-15' (PubMed:14635196). Plays an essential role in autophagy by tuning translation during starvation, thus enabling lysosomal biogenesis and a sustained autophagic flux (PubMed:32978159). Acts also a viral restriction factor by attenuating HIV-1 replication (PubMed:31778897). Mechanistically, mediates the inhibition of HIV-1 TAR RNA-mediated translation (PubMed:31778897). [The UniProt Consortium]
Schlagworte: Anti-GADD34, Anti-PPP1R15A, Anti-Protein phosphatase 1 regulatory subunit 15A, Anti-Growth arrest and DNA damage-inducible protein GADD34, Anti-Myeloid differentiation primary response protein MyD116 homolog, GADD34 Antibody / PPP1R15A
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ7101

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GADD34 / PPP1R15A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen