Anti-FZD1 / Frizzled 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59221.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Receptor for Wnt proteins (PubMed:10557084). Activated by WNT3A, WNT3, WNT1 and... mehr
Produktinformationen "Anti-FZD1 / Frizzled 1"
Protein function: Receptor for Wnt proteins (PubMed:10557084). Activated by WNT3A, WNT3, WNT1 and to a lesser extent WNT2, but apparently not by WNT4, WNT5A, WNT5B, WNT6, WNT7A or WNT7B (PubMed:10557084). Contradictory results showing activation by WNT7B have been described for mouse. Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed:10557084). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (PubMed:10557084). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable). [The UniProt Consortium]
Schlagworte: Anti-FZD1, Anti-FzE1, Anti-hFz1, Anti-Fz-1, Anti-Frizzled-1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59221

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 369-400 of Human FZD1 / Frizzled 1. (YIAGFLLEDRVVCNDKFAEDGARTVAQGTKKE)
MW: 71 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FZD1 / Frizzled 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen