Anti-FRA1 / Fos-related antigen 1

Anti-FRA1 / Fos-related antigen 1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4426 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein... mehr
Produktinformationen "Anti-FRA1 / Fos-related antigen 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
Schlagworte: Anti-FRA1, Anti-FOSL1, Anti-FRA-1, Anti-Fos-related antigen 1, FRA1 Antibody / Fos-related antigen 1
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4426

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FRA1 / Fos-related antigen 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen