Anti-FGB / Fibrinogen beta chain

Anti-FGB / Fibrinogen beta chain
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58574.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Cleaved by the protease thrombin to yield monomers which, together with... mehr
Produktinformationen "Anti-FGB / Fibrinogen beta chain"
Protein function: Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. [The UniProt Consortium]
Schlagworte: Anti-FGB
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58574

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 193-225 of Human FGB / Fibrinogen beta chain. (TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT)
MW: 56 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FGB / Fibrinogen beta chain"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen