Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
126717.100 | 100 µg | - | - |
3 - 19 Werktage* |
699,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box... mehr
Produktinformationen "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box proteins are divided into 3 classes: FBWs containing WD-40 domains, FBLs containing leucine-rich repeats, and FBXs containing either different protein-protein interaction modules or no recognizable motifs. They constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. Cdc4 is one member of this family, which is also known as AGO, FBW7, FBX30 or SEL10. CDC4 binds directly to cyclin E and targets cyclin E for ubiquitin-mediated degradation. Cdc4 proteins of amino acid lengths varying from 553aa to 707aa in length have been reported. Cdc4 is an inhibitor of Notch signaling that targets Notch for ubiquitin-mediated degradation after a nuclear phosphorylation event. Cdc4 interacts with presenilin 1, facilitates its ubiquitination, and alters A-beta peptide production. Thus, it may be important for Alzheimer's disease. Mutations of the CDC4 gene are detected in ovarian and breast cancer cell lines and the CDC4 gene may also be involved in the pathogenesis of human pancreatic and endometrial cancers. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: | United States Biological |
Hersteller-Nr: | 126717 |
Eigenschaften
Anwendung: | ELISA, IHC, WB |
Antikörper-Typ: | Monoclonal |
Klon: | 3D1 |
Konjugat: | No |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
Immunogen: | Partial recombinant corresponding to aa599-708 from human FBXW7 (NP_361014) with GST tag. MW of the GST tag alone is 26kD. |
Reinheit: | Purified by Protein A affinity chromatography. |
Format: | Affinity Purified |
Datenbank Information
KEGG ID : | K10260 | Passende Produkte |
UniProt ID : | Q969H0 | Passende Produkte |
Gene ID | GeneID 55294 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen