Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F

Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
126717.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box... mehr
Produktinformationen "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box proteins are divided into 3 classes: FBWs containing WD-40 domains, FBLs containing leucine-rich repeats, and FBXs containing either different protein-protein interaction modules or no recognizable motifs. They constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. Cdc4 is one member of this family, which is also known as AGO, FBW7, FBX30 or SEL10. CDC4 binds directly to cyclin E and targets cyclin E for ubiquitin-mediated degradation. Cdc4 proteins of amino acid lengths varying from 553aa to 707aa in length have been reported. Cdc4 is an inhibitor of Notch signaling that targets Notch for ubiquitin-mediated degradation after a nuclear phosphorylation event. Cdc4 interacts with presenilin 1, facilitates its ubiquitination, and alters A-beta peptide production. Thus, it may be important for Alzheimer's disease. Mutations of the CDC4 gene are detected in ovarian and breast cancer cell lines and the CDC4 gene may also be involved in the pathogenesis of human pancreatic and endometrial cancers. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 126717

Eigenschaften

Anwendung: ELISA, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 3D1
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa599-708 from human FBXW7 (NP_361014) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen