Anti-FABP4

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ABE-39-2008-100 100 µg -

3 - 11 Werktage*

801,00 €
 
Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly... mehr
Produktinformationen "Anti-FABP4"
Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma. Protein function: Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. [The UniProt Consortium]
Schlagworte: Anti-ALBP, Anti-AFABP, Anti-FABP4, Anti-A-FABP, Anti-Fatty acid-binding protein 4, Anti-Adipocyte lipid-binding protein, Anti-Fatty acid-binding protein, adipocyte, Anti-Adipocyte-type fatty acid-binding protein, Polyclonal Antibody to Anti-FABP4 Antibody
Hersteller: Abeomics
Hersteller-Nr: 39-2008

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FABP4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen