Anti-EWS / EWSR1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32181 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a multifunctional... mehr
Produktinformationen "Anti-EWS / EWSR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. Protein function: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. [The UniProt Consortium]
Schlagworte: Anti-EWS, Anti-EWSR1, Anti-EWS oncogene, Anti-RNA-binding protein EWS, Anti-Ewing sarcoma breakpoint region 1 protein, EWS Antibody / EWSR1
Hersteller-Nr: R32181

Eigenschaften

Anwendung: WB, IHC (paraffin), (IF), ICC
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-EWS / EWSR1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen