Anti-ELAVL2 / ELAV-like protein 2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4564 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in... mehr
Produktinformationen "Anti-ELAVL2 / ELAV-like protein 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. Protein function: Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR. [The UniProt Consortium]
Schlagworte: Anti-HUB, Anti-HuB, Anti-ELAVL2, Anti-Hu-antigen B, Anti-ELAV-like protein 2, Anti-ELAV-like neuronal protein 1, Anti-Nervous system-specific RNA-binding protein Hel-N1, ELAVL2 Antibody / ELAV-like protein 2
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4564

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ELAVL2 / ELAV-like protein 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen