Anti-Doppel / PRND

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4601 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prion protein 2 (dublet), also known as... mehr
Produktinformationen "Anti-Doppel / PRND"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. Protein function: Required for normal acrosome reaction and for normal male fertility. Can bind Cu(2+) (PubMed:15218028, PubMed:20411530). [The UniProt Consortium]
Schlagworte: Anti-DPL, Anti-PRND, Anti-PrPLP, Anti-Prion protein 2, Anti-Prion-like protein doppel, Doppel Antibody / PRND
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4601

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH
Format: Purified

Datenbank Information

UniProt ID : Q9UKY0 | Passende Produkte
Gene ID GeneID 23627 | Passende Produkte

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Doppel / PRND"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen