Anti-DHX15 / Prp43

Anti-DHX15 / Prp43
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5627 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Putative pre-mRNA-splicing factor... mehr
Produktinformationen "Anti-DHX15 / Prp43"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. Protein function: Pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. In cooperation with TFIP11 seem to be involved in the transition of the U2, U5 and U6 snRNP-containing IL complex to the snRNP-free IS complex leading to efficient debranching and turnover of excised introns. [The UniProt Consortium]
Schlagworte: Anti-DBP1, Anti-DHX15, Anti-DEAH box protein 15, Anti-ATP-dependent RNA helicase #46, Anti-Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DHX15 Antibody / Prp43
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5627

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DHX15 / Prp43"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen