Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-

Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
125831-PE.100 100 µl - -

3 - 19 Werktage*

927,00 €
 
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone... mehr
Produktinformationen "Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-"
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. Applications: Suitable for use in FLISA, Immunocytochemistry/Immunofluorescence and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV, Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Schlagworte: Anti-RDHL, Anti-RDH15, Anti-DHRS9, Anti-RDH-E2, Anti-RDH-TBE, EC=1.1.-.-, Anti-3-alpha-HSD, Anti-Retinol dehydrogenase 15, Anti-3-alpha hydroxysteroid dehydrogenase, Anti-Short-chain dehydrogenase/reductase retSDR8
Hersteller: United States Biological
Hersteller-Nr: 125831-PE

Eigenschaften

Anwendung: ELISA, ICC, IF, WB
Antikörper-Typ: Monoclonal
Klon: 3C6
Konjugat: Phycoerythrin
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen