Anti-DARPP-32

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32345 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit... mehr
Produktinformationen "Anti-DARPP-32"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Inhibitor of protein-phosphatase 1. [The UniProt Consortium]
Schlagworte: Anti-DARPP32, Anti-PPP1R1B, Anti-DARPP-32, Anti-Protein phosphatase 1 regulatory subunit 1B, Anti-Dopamine- and cAMP-regulated neuronal phosphoprotein, DARPP-32 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32345

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DARPP-32"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen