Anti-Cyclin T1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58314.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1)... mehr
Produktinformationen "Anti-Cyclin T1"
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). [The UniProt Consortium]
Schlagworte: Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58314

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine)
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related Mouse sequence by one amino acid
MW: 81 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cyclin T1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen