Anti-CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRM

Collapsin-response mediator proteins (CRMPs) are highly expressed in the developing brain where they play major roles in axonal outgrowth, neurite differentiation, and apoptosis. Their continued expression in areas of high synaptic remodeling such as the cerebellum, hippocampus, and the olfactory system suggests that these proteins may also be involved in adult brain plasticity. CRMP-1 was initially identified as a dihydro- pyrimidinase expressed exclusively in brain, later studies have shown that it is involved with neurotrophin (NT) 3-induced neurite formation and outgrowth. CRMP-1 localization switches from axonal to somatodendritic when neurons reach functional maturity, suggesting that it is involved in early neuronal differentiation as well as in later processes related to the survival or death of the newly generated neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.