Anti-Connexin 32 / GJB1

Anti-Connexin 32 / GJB1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4180 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction beta-1 protein (GJB1), also... mehr
Produktinformationen "Anti-Connexin 32 / GJB1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction beta-1 protein (GJB1), also known as Connexin 32 (Cx32) is a transmembrane protein that in humans is encoded by the GJB1 gene. This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene. Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]
Schlagworte: Anti-Cx32, Anti-GJB1, Anti-CX32, Anti-Connexin-32, Anti-Gap junction beta-1 protein, Anti-GAP junction 28 kDa liver protein, Connexin 32 Antibody / GJB1
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4180

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH were used as the immunogen for the Connexin 32 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Connexin 32 / GJB1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen