Anti-CDC25C

Anti-CDC25C
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32057 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. M-phase inducer phosphatase 3is... mehr
Produktinformationen "Anti-CDC25C"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. M-phase inducer phosphatase 3is anenzymethat in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. Protein function: Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. [The UniProt Consortium]
Schlagworte: Anti-CDC25C, EC=3.1.3.48, Anti-M-phase inducer phosphatase 3, Anti-Dual specificity phosphatase Cdc25C, CDC25C Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32057

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CDC25C"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen