Anti-CDC20

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42680.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Required for full ubiquitin ligase activity of the anaphase promoting... mehr
Produktinformationen "Anti-CDC20"
Protein function: Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation. [The UniProt Consortium]
Schlagworte: Anti-CDC20, Anti-p55CDC, Anti-Cell division cycle protein 20 homolog
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42680

Eigenschaften

Anwendung: FC, ICC, IF, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human CDC20. (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT)
MW: 55 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CDC20"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen