Anti-CD47 / IAP / Integrin Associated Protein

Anti-CD47 / IAP / Integrin Associated Protein
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32830 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD47, also known as IAP or MER6, is a... mehr
Produktinformationen "Anti-CD47 / IAP / Integrin Associated Protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Protein function: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. [The UniProt Consortium]
Schlagworte: Anti-IAP, Anti-MER6, Anti-CD47, Anti-Protein MER6, Anti-Integrin-associated protein, Anti-Leukocyte surface antigen CD47, Anti-Antigenic surface determinant protein OA3, CD47 Antibody / IAP / Integrin Associated Protein
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32830

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT were used as the immunogen for the CD47 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD47 / IAP / Integrin Associated Protein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen