Anti-CD119 / IFN gamma R1

Anti-CD119 / IFN gamma R1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40369.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma... mehr
Produktinformationen "Anti-CD119 / IFN gamma R1"
Protein function: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114). Plays an essential role in the IFN-gamma pathway that is required for the cellular response to infectious agents (PubMed:20015550). [The UniProt Consortium]
Schlagworte: Anti-CD119, Anti-CDw119, Anti-IFN-gamma-R1, Anti-IFN-gamma-R-alpha, Anti-IFN-gamma receptor 1, Anti-Interferon gamma receptor 1, Anti-Interferon gamma receptor alpha-chain
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40369

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 108-147 of Human CD119 / IFN gamma R1. (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH)
MW: 54 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD119 / IFN gamma R1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen