Anti-Cathepsin E

Anti-Cathepsin E
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58551.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: May have a role in immune function. Probably involved in the processing of... mehr
Produktinformationen "Anti-Cathepsin E"
Protein function: May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain. [The UniProt Consortium]
Schlagworte: Anti-CTSE, EC=3.4.23.34
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58551

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: horse)
Immunogen: Synthetic peptide of Human Cathepsin E. (within the following sequence: SLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG)
MW: 40 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cathepsin E"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen