Anti-BHLHB2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41307.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Transcriptional repressor involved in the regulation of the circadian rhythm by... mehr
Produktinformationen "Anti-BHLHB2"
Protein function: Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes (PubMed:12397359, PubMed:18411297). Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop) (PubMed:14672706). Both these loops are interlocked as it represses the expression of PER1/2 and in turn is repressed by PER1/2 and CRY1/2 (PubMed:15193144). Represses the activity of the circadian transcriptional activator: CLOCK- ARNTL/BMAL1, ARNTL2/BMAL2 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes (PubMed:15560782). Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2 (PubMed:14672706). Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA and NR1H3/LXRA transactivation activity (PubMed:19786558). May be involved in the regulation of chondrocyte differentiation via the cAMP pathway (PubMed:19786558). Represses the transcription of NR0B2 and attentuates the transactivation of NR0B2 by the CLOCK-ARNTL/BMAL1 complex (PubMed:28797635). Drives the circadian rhythm of blood pressure through transcriptional repression of ATP1B1 in the cardiovascular system (PubMed:30012868). [The UniProt Consortium]
Schlagworte: Anti-DEC1, Anti-bHLHb2, Anti-bHLHe40, Anti-SHARP-2, Anti-BHLHE40, Anti-Class B basic helix-loop-helix protein 2, Anti-Class E basic helix-loop-helix protein 40, Anti-Stimulated by retinoic acid gene 13 protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41307

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit, sheep)
Immunogen: Synthetic peptide around the middle region of Human BHLHB2. (within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE)
MW: 46 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-BHLHB2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen