Anti-ATG13

Anti-ATG13
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31833 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Autophagy-related protein 13, also known... mehr
Produktinformationen "Anti-ATG13"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Protein function: Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation. [The UniProt Consortium]
Schlagworte: Anti-ATG13, Anti-KIAA0652, Anti-Autophagy-related protein 13, ATG13 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31833

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ATG13"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen