Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
%
Rabattaktion
Aktion:
Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!
*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Rabatt | Preis |
---|---|---|---|---|---|---|---|---|
ARG58220.50 | 50 µg | - | - |
6 - 14 Werktage* |
30 %
|
508,00 €
355,60 € |
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular... mehr
Produktinformationen "Anti-ASIC2"
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [The UniProt Consortium]
Schlagworte: | Anti-MDEG, Anti-BNC1, Anti-ACCN, Anti-ASIC2, Anti-BNaC1, Anti-Brain sodium channel 1, Anti-Acid-sensing ion channel 2, Anti-Mammalian degenerin homolog, Anti-Amiloride-sensitive brain sodium channel, Anti-Amiloride-sensitive cation channel neuronal 1 |
Hersteller: | Arigo Biolaboratories |
Hersteller-Nr: | ARG58220 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat |
Immunogen: | Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK) |
MW: | 58 kD |
Format: | Antigen Affinity Purified |
Datenbank Information
KEGG ID : | K04828 | Passende Produkte |
UniProt ID : | Q16515 | Passende Produkte |
Gene ID | GeneID 40 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASIC2"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen