Anti-ASIC2

Anti-ASIC2
%
Rabattaktion
Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

*1
*1 Angebot gültig bis zum 16.12.2024
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Rabatt Preis
ARG58220.50 50 µg - -

6 - 14 Werktage*

30 %
508,00 €
355,60 €
 
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular... mehr
Produktinformationen "Anti-ASIC2"
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [The UniProt Consortium]
Schlagworte: Anti-MDEG, Anti-BNC1, Anti-ACCN, Anti-ASIC2, Anti-BNaC1, Anti-Brain sodium channel 1, Anti-Acid-sensing ion channel 2, Anti-Mammalian degenerin homolog, Anti-Amiloride-sensitive brain sodium channel, Anti-Amiloride-sensitive cation channel neuronal 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58220

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK)
MW: 58 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASIC2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen