Anti-Annexin A8

Anti-Annexin A8
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59661.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: This protein is an anticoagulant protein that acts as an indirect inhibitor of... mehr
Produktinformationen "Anti-Annexin A8"
Protein function: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. [The UniProt Consortium]
Schlagworte: Anti-ANX8, Anti-VAC-beta, Anti-Annexin-8, Anti-Annexin A8, Anti-Annexin VIII, Anti-Vascular anticoagulant-beta
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59661

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 20-61 of Human Annexin A8. (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK)
MW: 37 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Annexin A8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen