Anti-Annexin A4

Anti-Annexin A4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58211.50 50 µg - -

6 - 14 Werktage*

508,00 €
 
Protein function: Calcium/phospholipid-binding protein which promotes membrane fusion and is... mehr
Produktinformationen "Anti-Annexin A4"
Protein function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. [The UniProt Consortium]
Schlagworte: Anti-ANX4, Anti-ANXA4, Anti-PP4-X, Anti-P32.5, Anti-PAP-II, Anti-Annexin-4, Anti-Protein II, Anti-Annexin IV, Anti-Annexin A4, Anti-Endonexin I, Anti-Lipocortin IV, Anti-Chromobindin-4, Anti-35-beta calcimedin, Anti-Placental anticoagulant protein II
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58211

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related Mouse and Rat sequences by three amino acids
MW: 36 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Annexin A4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen