Anti-AKAP5

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
ARG41262.50	50 µl		-	-	6 - 14 Werktage*		520,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Protein function: May anchor the PKA protein to cytoskeletal and/or organelle-associated... mehr

Menü schließen

Produktinformationen "Anti-AKAP5"

Protein function: May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade. [The UniProt Consortium]

Schlagworte:	Anti-H21, Anti-AKAP5, Anti-AKAP-5, Anti-AKAP79, Anti-AKAP 79, Anti-A-kinase anchor protein 5, Anti-A-kinase anchor protein 79 kDa, Anti-cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein
Hersteller:	Arigo Biolaboratories
Hersteller-Nr:	ARG41262

Eigenschaften

Anwendung:	WB
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human (Erwartet: mouse, rat, cow, dog, horse, swine, yeast)
Immunogen:	Synthetic peptide around the middle region of Human AKAP5. (within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE)
MW:	47 kD
Format:	Affinity Purified

Datenbank Information

KEGG ID :	K16522 \| Passende Produkte
UniProt ID :	P24588 \| Passende Produkte
Gene ID	GeneID 9495 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	-20°C
Versand:	+4°C (International: °C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody ARG41262 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "Anti-AKAP5"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.