Anti-ACCN1 / ASIC2

Anti-ACCN1 / ASIC2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32514 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amiloride-sensitive cation channel 1,... mehr
Produktinformationen "Anti-ACCN1 / ASIC2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified. Protein function: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [The UniProt Consortium]
Schlagworte: Anti-MDEG, Anti-ACCN, Anti-BNC1, Anti-ASIC2, Anti-BNaC1, Anti-Brain sodium channel 1, Anti-Acid-sensing ion channel 2, Anti-Mammalian degenerin homolog, Anti-Amiloride-sensitive brain sodium channel, Anti-Amiloride-sensitive cation channel neuronal 1, ACC
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32514

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ACCN1 / ASIC2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen