Products from Atlas Antibodies

Atlas Antibodies

Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.

More information at: www.atlasantibodies.com

Go to the catalogs of Atlas Antibodies

3762 from 3759 pages
No results were found for the filter!
CTNS PrEST Antigen
CTNS PrEST Antigen

Item number: ATA-APrEST96215.100

PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
Keywords: CTNS, Cystinosin
Expressed in: E.coli
Origin: human
264.00€ *
Review
NFIC PrEST Antigen
NFIC PrEST Antigen

Item number: ATA-APrEST96219.100

PrEST Antigen NFIC, Gene description: nuclear factor I C, Alternative Gene Names: CTF, CTF5, NF-I, NFI, Antigen sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Recognizes and binds the palindromic sequence 5'-...
Keywords: CTF, NFI, NFIC, NFI-C, NF1-C, NF-I/C, Nuclear factor I/C, Nuclear factor 1/C, TGGCA-binding protein, Nuclear factor 1...
Expressed in: E.coli
Origin: human
264.00€ *
Review
3762 from 3759 pages