Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
ULBP2 PrEST Antigen
Item number: ATA-APrEST95763.100
PrEST Antigen ULBP2, Gene description: UL16 binding protein 2, Alternative Gene Names: RAET1H, Antigen sequence: AWKAQNPVLREVVDILTEQLRDIQLENY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell...
| Keywords: | N2DL2, ULBP2, N2DL-2, NKG2DL2, ALCAN-alpha, NKG2D ligand 2, UL16-binding protein 2, Retinoic acid early transcript 1H |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CSMD3 PrEST Antigen
Item number: ATA-APrEST95764.100
PrEST Antigen CSMD3, Gene description: CUB and Sushi multiple domains 3, Antigen sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in dendrite development. [The...
| Keywords: | CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZNF385A PrEST Antigen
Item number: ATA-APrEST95774.100
PrEST Antigen ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Antigen sequence: PVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein...
| Keywords: | HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TMCO5A PrEST Antigen
Item number: ATA-APrEST95787.100
PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Antigen sequence: EETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 71%...
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
STAU2 PrEST Antigen
Item number: ATA-APrEST95800.100
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding...
| Keywords: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RAB5IF PrEST Antigen
Item number: ATA-APrEST95809.100
PrEST Antigen RAB5IF, Gene description: RAB5 interacting factor, Alternative Gene Names: C20orf24, PNAS-11, RCAF1, RIP5, Antigen sequence: LYFSNYLQIDEEEYGGTWELTKEGFM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as an assembly factor for mitochondrial respiratory...
| Keywords: | RIP5, PNAS-11, Rab5-interacting protein, Respirasome Complex Assembly Factor 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
EPS8 PrEST Antigen
Item number: ATA-APrEST95811.100
PrEST Antigen EPS8, Gene description: epidermal growth factor receptor pathway substrate 8, Antigen sequence: SFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESSNELENFP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | EPS8, Epidermal growth factor receptor kinase substrate 8 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FBXL5 PrEST Antigen
Item number: ATA-APrEST95812.100
PrEST Antigen FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Antigen sequence: VSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLKTSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADI, Storage: Upon delivery...
| Keywords: | FBL4, FBXL5, p45SKP2-like protein, F-box protein FBL4/FBL5, F-box/LRR-repeat protein 5, F-box and leucine-rich repeat... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
JPH4 PrEST Antigen
Item number: ATA-APrEST95836.100
PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute...
| Keywords: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SHLD2 PrEST Antigen
Item number: ATA-APrEST95845.100
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
REPS1 PrEST Antigen
Item number: ATA-APrEST95848.100
PrEST Antigen REPS1, Gene description: RALBP1 associated Eps domain containing 1, Antigen sequence: SKNEQESRHAASYSSDSENQGSYSGVIPPPPGRGQVKKGSVSHDTVQPRTSADAQEPASPVVSPQQSPPTSPHTWRKHSRHP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinate the cellular actions of...
| Keywords: | REPS1, RalBP1-interacting protein 1, RalBP1-associated Eps domain-containing protein 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
DEDD PrEST Antigen
Item number: ATA-APrEST95851.100
PrEST Antigen DEDD, Gene description: death effector domain containing, Alternative Gene Names: CASP8IP1, DEDD1, DEFT, FLDED1, KE05, Antigen sequence: PEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A scaffold...
| Keywords: | KE05, DEDD, FLDED-1, DEDPRO1, DEDPro1, Death effector domain-containing protein, Death effector domain-containing... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*