Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
ZNF112 PrEST Antigen
Item number: ATA-APrEST95699.100
PrEST Antigen ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Antigen sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved...
| Keywords: | ZNF112, ZFP112, Zfp-112, Zinc finger protein 112, Zinc finger protein 228 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CSAD PrEST Antigen
Item number: ATA-APrEST95706.100
PrEST Antigen CSAD, Gene description: cysteine sulfinic acid decarboxylase, Alternative Gene Names: CSD, PCAP, Antigen sequence: KECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the decarboxylation of...
| Keywords: | CSD, CSAD, Aspartate 1-decarboxylase, Sulfinoalanine decarboxylase, Cysteine-sulfinate decarboxylase, Cysteine sulfinic... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
JUND PrEST Antigen
Item number: ATA-APrEST95708.100
PrEST Antigen JUND, Gene description: JunD proto-oncogene, AP-1 transcription factor subunit, Alternative Gene Names: AP-1, Antigen sequence: AAGSMMKKDALTLSLSEQVAAALKPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor binding AP-1 sites. [The UniProt...
| Keywords: | JUND, Transcription factor jun-D |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
HLA-DOA PrEST Antigen
Item number: ATA-APrEST95717.100
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TAS2R10 PrEST Antigen
Item number: ATA-APrEST95727.100
PrEST Antigen TAS2R10, Gene description: taste 2 receptor member 10, Alternative Gene Names: T2R10, TRB2, Antigen sequence: FAYIAKILNDYKMKNDTVWDLNMYK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Gustducin-coupled strychnine receptor implicated in the perception of...
| Keywords: | TRB2, T2R10, TAS2R10, Taste receptor type 2 member 10, Taste receptor family B member 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SPCS2 PrEST Antigen
Item number: ATA-APrEST95732.100
PrEST Antigen SPCS2, Gene description: signal peptidase complex subunit 2, Alternative Gene Names: KIAA0102, Antigen sequence: EKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the microsomal signal peptidase complex...
| Keywords: | SPCS2, KIAA0102, EC=3.4.-.-, SPase 25 kDa subunit, Signal peptidase complex subunit 2, Microsomal signal peptidase 25 kDa... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FTCDNL1 PrEST Antigen
Item number: ATA-APrEST95733.100
PrEST Antigen FTCDNL1, Gene description: formiminotransferase cyclodeaminase N-terminal like, Alternative Gene Names: FONG, Antigen sequence: HVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTACFRAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 26% Rat gene...
| Keywords: | FONG, FTCDNL1, Formiminotransferase-cyclodeaminase N-terminal-like protein, Formiminotransferase N-terminal... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
STAM PrEST Antigen
Item number: ATA-APrEST95734.100
PrEST Antigen STAM, Gene description: signal transducing adaptor molecule, Alternative Gene Names: STAM1, Antigen sequence: YTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | STAM, STAM1, STAM-1, Signal transducing adapter molecule 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PLA2G4D PrEST Antigen
Item number: ATA-APrEST95740.100
PrEST Antigen PLA2G4D, Gene description: phospholipase A2 group IVD, Alternative Gene Names: cPLA2delta, Antigen sequence: VLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent...
| Keywords: | cPLA2-delta, Phospholipase A2 group IVD, Cytosolic phospholipase A2 delta |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PDCL2 PrEST Antigen
Item number: ATA-APrEST95742.100
PrEST Antigen PDCL2, Gene description: phosducin like 2, Alternative Gene Names: GCPHLP, Antigen sequence: PETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a role in germ cell maturation. [The UniProt...
| Keywords: | PDCL2, Phosducin-like protein 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PRDX3 PrEST Antigen
Item number: ATA-APrEST95744.100
PrEST Antigen PRDX3, Gene description: peroxiredoxin 3, Alternative Gene Names: AOP-1, AOP1, MER5, SP-22, Antigen sequence: TKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Thiol-specific peroxidase that catalyzes the reduction of...
| Keywords: | AOP1, PRDX3, AOP-1, HBC189, Prx-III, Peroxiredoxin-3, Peroxiredoxin III, Protein MER5 homolog, Antioxidant protein 1,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
AQP11 PrEST Antigen
Item number: ATA-APrEST95758.100
PrEST Antigen AQP11, Gene description: aquaporin 11, Alternative Gene Names: AQPX1, Antigen sequence: RYCTSALWSLGLTQYHVSERSFACKNPIRVDLLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Channel protein that facilitates the transport of water, glycerol and hydrogen peroxide...
| Keywords: | AQPX1, AQP-11, PSEC0027, Aquaporin-11 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*