Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
PPP1R14C PrEST Antigen
Item number: ATA-APrEST95640.100
PrEST Antigen PPP1R14C, Gene description: protein phosphatase 1 regulatory inhibitor subunit 14C, Alternative Gene Names: CPI17-like, KEPI, NY-BR-81, Antigen sequence: IDIDDLLDADSDEERASKLQEALVDCY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Inhibitor of the PP1...
| Keywords: | KEPI, PPP1R14C, Kinase-enhanced PP1 inhibitor, PKC-potentiated PP1 inhibitory protein, Protein phosphatase 1 regulatory... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
HSPB9 PrEST Antigen
Item number: ATA-APrEST95651.100
PrEST Antigen HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Antigen sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 55% Rat...
| Keywords: | CT51, HSPB9, HspB9, Cancer/testis antigen 51, Heat shock protein beta-9 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CD79A PrEST Antigen
Item number: ATA-APrEST95654.100
PrEST Antigen CD79A, Gene description: CD79a molecule, Alternative Gene Names: Ig-alpha, IGA, IGAlpha, MB-1, MB1, Antigen sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required in cooperation with CD79B for...
| Keywords: | IGA, CD79a, CD79A, Ig-alpha, MB-1 membrane glycoprotein, Surface IgM-associated protein, Membrane-bound... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SEC14L4 PrEST Antigen
Item number: ATA-APrEST95663.100
PrEST Antigen SEC14L4, Gene description: SEC14 like lipid binding 4, Alternative Gene Names: dJ130H16.5, TAP3, Antigen sequence: ELQTQKLGRKIEMALMVFDME, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Probable hydrophobic ligand-binding protein, may play a role in the...
| Keywords: | TAP3, SEC14L4, SEC14-like protein 4, Tocopherol-associated protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
AKAP3 PrEST Antigen
Item number: ATA-APrEST95673.100
PrEST Antigen AKAP3, Gene description: A-kinase anchoring protein 3, Alternative Gene Names: AKAP110, CT82, FSP95, SOB1, Antigen sequence: FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | CT82, AKAP3, PRKA3, FSP95, AKAP-3, AKAP110, AKAP 110, Fibrousheathin I, Fibrousheathin-1, Cancer/testis antigen 82,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
DRD4 PrEST Antigen
Item number: ATA-APrEST95681.100
PrEST Antigen DRD4, Gene description: dopamine receptor D4, Antigen sequence: YSEVQGGAWLLSPRLCDALM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that...
| Keywords: | DRD4, Dopamine D4 receptor, D(4) dopamine receptor, D(2C) dopamine receptor |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
NFAT5 PrEST Antigen
Item number: ATA-APrEST95684.100
PrEST Antigen NFAT5, Gene description: nuclear factor of activated T cells 5, Alternative Gene Names: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Antigen sequence: TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | NFAT5, NF-AT5, TonEBP, KIAA0827, TonE-binding protein, T-cell transcription factor NFAT5, Nuclear factor of activated... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FN3KRP PrEST Antigen
Item number: ATA-APrEST95687.100
PrEST Antigen FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Antigen sequence: GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ketosamine-3-kinase involved in protein...
| Keywords: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PTGDS PrEST Antigen
Item number: ATA-APrEST95689.100
PrEST Antigen PTGDS, Gene description: prostaglandin D2 synthase, Alternative Gene Names: L-PGDS, PGDS, Antigen sequence: PRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the conversion of PGH2 to PGD2, a prostaglandin...
| Keywords: | PDS, PGDS, PTGDS, PGDS2, L-PGDS, Cerebrin-28, PGD2 synthase, Beta-trace protein, Prostaglandin-D2 synthase,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RIGI PrEST Antigen
Item number: ATA-APrEST95691.100
PrEST Antigen RIGI, Gene description: RNA sensor RIG-I, Alternative Gene Names: DDX58, DKFZp434J1111, FLJ13599, RIG-1, RIG-I, RIG1, Antigen sequence: CSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | DDX58, RIG-I, RIG-1, RLR-1, EC=3.6.4.13, DEAD box protein 58, RIG-I-like receptor 1, Retinoic acid-inducible gene I... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
KMT2C PrEST Antigen
Item number: ATA-APrEST95694.100
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ST6GALNAC6 PrEST Antigen
Item number: ATA-APrEST95697.100
PrEST Antigen ST6GALNAC6, Gene description: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, Alternative Gene Names: SIAT7F, ST6GALNACVI, Antigen sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transfers the...
| Keywords: | SIAT7F, SIAT7-F, ST6GALNAC6, ST6GalNAcVI, ST6GalNAc VI, hST6GalNAc VI, Sialyltransferase 7F, GalNAc... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*