Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
CDHR1 PrEST Antigen
Item number: ATA-APrEST95578.100
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Antigen sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV, Storage: Upon delivery store at -20°C. Avoid...
| Keywords: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
VWDE PrEST Antigen
Item number: ATA-APrEST95602.100
PrEST Antigen VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Antigen sequence: LLTTQQITVRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSGVYLCVCLPGFHGSLCEVDISGCQSNPCGLGSYISGFHSYSCDCPPELKVETQFVNQFTTQTVVLTRSDKSVN, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
KDR PrEST Antigen
Item number: ATA-APrEST95603.100
PrEST Antigen KDR, Gene description: kinase insert domain receptor, Alternative Gene Names: CD309, FLK1, VEGFR, VEGFR2, Antigen sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | KDR, FLK1, FLK-1, CD309, VEGFR-2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZBTB8B PrEST Antigen
Item number: ATA-APrEST95606.100
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CHRNA2 PrEST Antigen
Item number: ATA-APrEST95611.100
PrEST Antigen CHRNA2, Gene description: cholinergic receptor nicotinic alpha 2 subunit, Antigen sequence: RWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEEDRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: After binding acetylcholine,...
| Keywords: | CHRNA2, Neuronal acetylcholine receptor subunit alpha-2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
JPT1 PrEST Antigen
Item number: ATA-APrEST95614.100
PrEST Antigen JPT1, Gene description: Jupiter microtubule associated homolog 1, Alternative Gene Names: ARM2, HN1, HN1A, Antigen sequence: TTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPSRRNP, Storage: Upon delivery store at...
| Keywords: | ARM2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
H3-4 PrEST Antigen
Item number: ATA-APrEST95617.100
PrEST Antigen H3-4, Gene description: H3.4 histone, cluster member, Alternative Gene Names: H3.4, H3/g, H3C16, H3FT, H3t, HIST3H3, Antigen sequence: MARTKQTARKSTGGKAPRKQLATKVARKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Core component of nucleosome. Nucleosomes...
| Keywords: | H3t, H3/g, H3FT, H3/t, Histone H3.4, Histone H3.1t |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
POP4 PrEST Antigen
Item number: ATA-APrEST95619.100
PrEST Antigen POP4, Gene description: POP4 homolog, ribonuclease P/MRP subunit, Alternative Gene Names: RPP29, Antigen sequence: SVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of ribonuclease P,...
| Keywords: | POP4, hPOP4, RPP29, Ribonuclease P protein subunit p29 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
NF1 PrEST Antigen
Item number: ATA-APrEST95621.100
PrEST Antigen NF1, Gene description: neurofibromin 1, Antigen sequence: MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Stimulates the GTPase activity of Ras. NF1 shows greater affinity for Ras GAP, but lower specific activity. May...
| Keywords: | NF1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
DYNC1LI2 PrEST Antigen
Item number: ATA-APrEST95624.100
PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic...
| Keywords: | LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CNGA4 PrEST Antigen
Item number: ATA-APrEST95627.100
PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RBM46 PrEST Antigen
Item number: ATA-APrEST95630.100
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*