Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
TFEB PrEST Antigen
Item number: ATA-APrEST96174.100
PrEST Antigen TFEB, Gene description: transcription factor EB, Alternative Gene Names: bHLHe35, TCFEB, Antigen sequence: YHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor that acts as a master...
| Keywords: | BHLHE35, bHLHe35, Transcription factor EB, Class E basic helix-loop-helix protein 35 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FAT3 PrEST Antigen
Item number: ATA-APrEST96175.100
PrEST Antigen FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Antigen sequence: PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | FAT3, hFat3, CDHF15, Protocadherin Fat 3, Cadherin family member 15, FAT tumor suppressor homolog 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZP3 PrEST Antigen
Item number: ATA-APrEST96177.100
PrEST Antigen ZP3, Gene description: zona pellucida glycoprotein 3, Alternative Gene Names: ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC, Antigen sequence: CLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | ZP3, ZP3A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ARHGAP17 PrEST Antigen
Item number: ATA-APrEST96178.100
PrEST Antigen ARHGAP17, Gene description: Rho GTPase activating protein 17, Alternative Gene Names: FLJ10308, FLJ13219, NADRIN, RICH1, WBP15, Antigen sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | RICH1, RICH-1, MSTP066, ARHGAP17, Rho GTPase-activating protein 17, Rho-type GTPase-activating protein 17, RhoGAP... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MCCC1 PrEST Antigen
Item number: ATA-APrEST96186.100
PrEST Antigen MCCC1, Gene description: methylcrotonyl-CoA carboxylase subunit 1, Alternative Gene Names: MCCA, MCCCalpha, Antigen sequence: LLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | MCCA, MCCC1, EC=6.4.1.4, MCCase subunit alpha, 3-methylcrotonyl-CoA carboxylase 1, 3-methylcrotonyl-CoA:carbon dioxide... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
IL11RA PrEST Antigen
Item number: ATA-APrEST96192.100
PrEST Antigen IL11RA, Gene description: interleukin 11 receptor subunit alpha, Antigen sequence: RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for interleukin-11 (IL11)....
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
AP1M2 PrEST Antigen
Item number: ATA-APrEST96203.100
PrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Subunit of clathrin-associated...
| Keywords: | AP1M2, Mu1B-adaptin, Mu-adaptin 2, AP-1 complex subunit mu-2, AP-mu chain family member mu1B, Adaptor protein complex AP-1... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C20orf173 PrEST Antigen
Item number: ATA-APrEST96207.100
PrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 31% Rat gene identity: 31%
| Keywords: | C20orf173, Uncharacterized protein C20orf173 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TMPRSS11E PrEST Antigen
Item number: ATA-APrEST96228.100
PrEST Antigen TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Antigen sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Serine...
| Keywords: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZNF226 PrEST Antigen
Item number: ATA-APrEST96237.100
PrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
| Keywords: | ZNF226, Zinc finger protein 226 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ATP13A5 PrEST Antigen
Item number: ATA-APrEST95842.100
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen sequence: FGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat gene identity: 72%
| Keywords: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C2CD4A PrEST Antigen
Item number: ATA-APrEST95847.100
PrEST Antigen C2CD4A, Gene description: C2 calcium dependent domain containing 4A, Alternative Gene Names: FAM148A, NLF1, Antigen sequence: IPPRLMPRLALAALRNSWVEEAGMD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in inflammatory process. May regulate cell...
| Keywords: | C2CD4A, FAM148A, Protein FAM148A, Nuclear-localized factor 1, C2 calcium-dependent domain-containing protein 4A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*