Products from Atlas Antibodies

Atlas Antibodies

Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.

More information at: www.atlasantibodies.com

Go to the catalogs of Atlas Antibodies

3743 from 3743 pages
No results were found for the filter!
CMPK2 PrEST Antigen
CMPK2 PrEST Antigen

Item number: ATA-APrEST96168.100

PrEST Antigen CMPK2, Gene description: cytidine/uridine monophosphate kinase 2, Alternative Gene Names: NDK, TYKi, UMP-CMPK2, Antigen sequence: DRYWHSTATYAIATEVSGGLQHLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENPGCHVV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: CMPK2, EC=2.7.4.6, EC=2.7.4.14, Nucleoside-diphosphate kinase, UMP-CMP kinase 2, mitochondrial
Expressed in: E.coli
Origin: human
264.00€ *
Review
CD1E PrEST Antigen
CD1E PrEST Antigen

Item number: ATA-APrEST96173.100

PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl...
Keywords: CD1E
Expressed in: E.coli
Origin: human
264.00€ *
Review
ARHGEF6 PrEST Antigen
ARHGEF6 PrEST Antigen

Item number: ATA-APrEST96184.100

PrEST Antigen ARHGEF6, Gene description: Rac/Cdc42 guanine nucleotide exchange factor 6, Alternative Gene Names: alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46, Antigen sequence: GSVEKFCLDPQTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVSSTVSGLQR, Storage: Upon delivery store at...
Keywords: COOL2, COOL-2, ARHGEF6, Alpha-Pix, PAK-interacting exchange factor alpha, Rho guanine nucleotide exchange factor 6,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
RNASEL PrEST Antigen
RNASEL PrEST Antigen

Item number: ATA-APrEST96189.100

PrEST Antigen RNASEL, Gene description: ribonuclease L, Alternative Gene Names: PRCA1, RNS4, Antigen sequence: IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: RNS4, RNASEL, RNase L, EC=3.1.26.-, Ribonuclease 4, Ribonuclease L, 2-5A-dependent RNase, 2-5A-dependent ribonuclease
Expressed in: E.coli
Origin: human
264.00€ *
Review
TAGLN PrEST Antigen
TAGLN PrEST Antigen

Item number: ATA-APrEST96196.100

PrEST Antigen TAGLN, Gene description: transgelin, Alternative Gene Names: DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10, Antigen sequence: KNDGHYRGDPNWFMKKAQEHKREFTESQLQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Actin cross-linking/gelling protein. Involved in calcium...
Keywords: SM22, TAGLN, SM22-alpha, Transgelin, Protein WS3-10, 22 kDa actin-binding protein, Smooth muscle protein 22-alpha
Expressed in: E.coli
Origin: human
264.00€ *
Review
H3-3B PrEST Antigen
H3-3B PrEST Antigen

Item number: ATA-APrEST96214.100

PrEST Antigen H3-3B, Gene description: H3.3 histone B, Alternative Gene Names: H3.3B, H3F3B, Antigen sequence: KPHRYRPGTVALREIRRYQKSTELLIR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in...
Keywords: H3.3B, PP781, H3.3A, Histone H3.3
Expressed in: E.coli
Origin: human
264.00€ *
Review
CTNS PrEST Antigen
CTNS PrEST Antigen

Item number: ATA-APrEST96215.100

PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
Keywords: CTNS, Cystinosin
Expressed in: E.coli
Origin: human
264.00€ *
Review
NFIC PrEST Antigen
NFIC PrEST Antigen

Item number: ATA-APrEST96219.100

PrEST Antigen NFIC, Gene description: nuclear factor I C, Alternative Gene Names: CTF, CTF5, NF-I, NFI, Antigen sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Recognizes and binds the palindromic sequence 5'-...
Keywords: CTF, NFI, NFIC, NFI-C, NF1-C, NF-I/C, Nuclear factor I/C, Nuclear factor 1/C, TGGCA-binding protein, Nuclear factor 1...
Expressed in: E.coli
Origin: human
264.00€ *
Review
3743 from 3743 pages