Products from Atlas Antibodies

Atlas Antibodies

Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.

More information at: www.atlasantibodies.com

Go to the catalogs of Atlas Antibodies

3740 from 3741 pages
No results were found for the filter!
CAD PrEST Antigen
CAD PrEST Antigen

Item number: ATA-APrEST96125.100

PrEST Antigen CAD, Gene description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, Alternative Gene Names: GATD4, Antigen sequence: FSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPP, Storage: Upon delivery...
Keywords: CAD protein, Dihydroorotase, Aspartate carbamoyltransferase, Glutamine-dependent carbamoyl-phosphate synthase
Expressed in: E.coli
Origin: human
264.00€ *
Review
GJC1 PrEST Antigen
GJC1 PrEST Antigen

Item number: ATA-APrEST96132.100

PrEST Antigen GJC1, Gene description: gap junction protein gamma 1, Alternative Gene Names: CX45, GJA7, Antigen sequence: AKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMMYPEMELESDKENKEQSQPKPKHDGRRRIREDGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: One gap junction consists...
Keywords: GJC1, GJA7, Cx45, Connexin-45, Gap junction gamma-1 protein, Gap junction alpha-7 protein
Expressed in: E.coli
Origin: human
264.00€ *
Review
CCR9 PrEST Antigen
CCR9 PrEST Antigen

Item number: ATA-APrEST96133.100

PrEST Antigen CCR9, Gene description: C-C motif chemokine receptor 9, Alternative Gene Names: CDw199, GPR-9-6, GPR28, Antigen sequence: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for chemokine SCYA25/TECK. Subsequently...
Keywords: CCR9, GPR28, CCR-9, CDw199, GPR-9-6, CC-CKR-9, C-C CKR-9, C-C chemokine receptor type 9, G-protein coupled receptor 28
Expressed in: E.coli
Origin: human
264.00€ *
Review
ZNF775 PrEST Antigen
ZNF775 PrEST Antigen

Item number: ATA-APrEST96140.100

PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Antigen sequence: GTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
Keywords: ZNF775, Zinc finger protein 775
Expressed in: E.coli
Origin: human
264.00€ *
Review
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Item number: ATA-APrEST96141.100

PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Expressed in: E.coli
Origin: human
264.00€ *
Review
DND1 PrEST Antigen
DND1 PrEST Antigen

Item number: ATA-APrEST96145.100

PrEST Antigen DND1, Gene description: DND microRNA-mediated repression inhibitor 1, Alternative Gene Names: MGC34750, RBMS4, Antigen sequence: MMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: DND1, RBMS4, Dead end protein homolog 1, RNA-binding motif, single-stranded-interacting protein 4
Expressed in: E.coli
Origin: human
264.00€ *
Review
PACS1 PrEST Antigen
PACS1 PrEST Antigen

Item number: ATA-APrEST96148.100

PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative Gene Names: FLJ10209, KIAA1175, Antigen sequence: GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Coat protein that is...
Keywords: PACS1, PACS-1, KIAA1175, Phosphofurin acidic cluster sorting protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Review
C15orf40 PrEST Antigen
C15orf40 PrEST Antigen

Item number: ATA-APrEST96150.100

PrEST Antigen C15orf40, Gene description: chromosome 15 open reading frame 40, Alternative Gene Names: MGC29937, Antigen sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 78% Rat gene identity: 78%
Keywords: C15orf40, UPF0235 protein C15orf40
Expressed in: E.coli
Origin: human
264.00€ *
Review
MUC5AC PrEST Antigen
MUC5AC PrEST Antigen

Item number: ATA-APrEST96151.100

PrEST Antigen MUC5AC, Gene description: mucin 5AC, oligomeric mucus/gel-forming, Alternative Gene Names: MUC5, Antigen sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Gel-forming...
Keywords: TBM, MUC-5AC, Mucin-5AC, Gastric mucin, Tracheobronchial mucin, Major airway glycoprotein, Mucin-5 subtype AC,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
CYP11B2 PrEST Antigen
CYP11B2 PrEST Antigen

Item number: ATA-APrEST96158.100

PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A...
Keywords: ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
ESR2 PrEST Antigen
ESR2 PrEST Antigen

Item number: ATA-APrEST96163.100

PrEST Antigen ESR2, Gene description: estrogen receptor 2, Alternative Gene Names: ER-beta, Erb, NR3A2, Antigen sequence: LNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: ESR2, ESTRB, ER-beta, Estrogen receptor beta, Nuclear receptor subfamily 3 group A member 2
Expressed in: E.coli
Origin: human
264.00€ *
Review
PDCD6IP PrEST Antigen
PDCD6IP PrEST Antigen

Item number: ATA-APrEST96165.100

PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative Gene Names: AIP1, Alix, Hp95, Antigen sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Multifunctional...
Keywords: AIP1, Hp95, PDCD6IP, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Programmed cell...
Expressed in: E.coli
Origin: human
264.00€ *
Review
3740 from 3741 pages