Interleukin-8, Recombinant, Chicken, aa17-102, His-Tag (IL8)

May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chotactic for peripheral blood mononuclear cells as well as for heterophils. Source: Recombinant protein corresponding to aa17-102 from chicken IL8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.5kD, AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.