Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
I8443-17.10 | 10 µg | - | - |
3 - 19 Werktage* |
909,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells... mehr
Produktinformationen "Interleukin-22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF), rat recombinant (rrIL"
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways. Source: A DNA sequence encoding the putative mature rat Interleukin 22 protein sequence expressed in E. coli. Amino Acid Sequence: MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV, Molecular Mass: The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD. Activity: Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml., Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA/1ug of cytokine. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Hersteller: | United States Biological |
Hersteller-Nr: | I8443-17 |
Eigenschaften
Konjugat: | No |
Wirt: | E.coli |
Spezies-Reaktivität: | rat |
Format: | Highly Purified |
Datenbank Information
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Interleukin-22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF), rat recombinant (rrIL"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen