Interleukin-10, Recombinant, Macaca Mulatta, aa19-178, His-B2M-tag (IL10)

Interleukin-10, Recombinant, Macaca Mulatta, aa19-178, His-B2M-tag (IL10)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405960.20 20 µg - -

3 - 19 Werktage*

511,00 €
405960.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF... mehr
Produktinformationen "Interleukin-10, Recombinant, Macaca Mulatta, aa19-178, His-B2M-tag (IL10)"
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Source: Recombinant full length protein corresponding to aa19-178 from macaca mulatta Interleukin-10, fused to His-B2M-tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.7kD, AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CSIF, IL10, IL-10, Interleukin-10, Cytokine synthesis inhibitory factor
Hersteller: United States Biological
Hersteller-Nr: 405960

Eigenschaften

Konjugat: No
MW: 32,7
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Interleukin-10, Recombinant, Macaca Mulatta, aa19-178, His-B2M-tag (IL10)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen