GM-CSF protein(N-His)(active) (recombinant swine)

GM-CSF protein(N-His)(active) (recombinant swine)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSS000024.20 20 µg -

7 - 16 Werktage*

588,00 €
 
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect... mehr
Produktinformationen "GM-CSF protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
Schlagworte: CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF protein(N-His)(active)
Hersteller: Elabscience
Hersteller-Nr: E-PKSS000024

Eigenschaften

Anwendung: Active, Cell culture
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: swine
MW: 17.08 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: 4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "GM-CSF protein(N-His)(active) (recombinant swine)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen