Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269, PubMed:16597617, ECO:0000269, PubMed:20145243, ECO:0000269, PubMed:8663044}. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5ng/ml, corresponding to a specific activity of ? 2.0x10e6 IU/mg in the presence of 10ug/ml of heparin. Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D, Molecular Weight: 16.0kD, PubMed ID: 3523756, 2590193, 2474753, 1693186, 1717925, 1372643, 7504343, 14702039, 15372022, 15489334, 2393407, 2427112, 3527167, 3778488, 3964259, 3732516, 1885605, 8663044, 11432880, 11964394, 16597617, 18400376, 20863990, 15863030, 20094046, 22321063, 1702556, 8652550, 9655399, 10830168, 11069186, 10618369, 11847269, 14732692, 7521397, 8950275, 9719643, 20145243, 20220137, Gene Name: FGF1, FGFA, Swiss Prot: P05230, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.