Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
348040.10 | 10 µg | - | - |
3 - 19 Werktage* |
454,00 €
|
||
348040.100 | 100 µg | - | - |
3 - 19 Werktage* |
863,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell... mehr
Produktinformationen "Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human"
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269, PubMed:16597617, ECO:0000269, PubMed:20145243, ECO:0000269, PubMed:8663044}. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5ng/ml, corresponding to a specific activity of ? 2.0x10e6 IU/mg in the presence of 10ug/ml of heparin. Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D, Molecular Weight: 16.0kD, PubMed ID: 3523756, 2590193, 2474753, 1693186, 1717925, 1372643, 7504343, 14702039, 15372022, 15489334, 2393407, 2427112, 3527167, 3778488, 3964259, 3732516, 1885605, 8663044, 11432880, 11964394, 16597617, 18400376, 20863990, 15863030, 20094046, 22321063, 1702556, 8652550, 9655399, 10830168, 11069186, 10618369, 11847269, 14732692, 7521397, 8950275, 9719643, 20145243, 20220137, Gene Name: FGF1, FGFA, Swiss Prot: P05230, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: | aFGF, ECGF, FGFA, FGF1, FGF-1, HBGF-1, Fibroblast growth factor 1, Endothelial cell growth factor, Acidic fibroblast growth factor, Heparin-binding growth factor 1 |
Hersteller: | United States Biological |
Hersteller-Nr: | 348040 |
Eigenschaften
Konjugat: | No |
MW: | 16 |
Format: | Highly Purified |
Datenbank Information
KEGG ID : | K18496 | Passende Produkte |
UniProt ID : | P05230 | Passende Produkte |
Gene ID | GeneID 2246 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen