YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein Yippee-like 1)

Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.