- Suchergebnis für O60688
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "O60688" wurden 5 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: 600-401-GA9
Anti-ZBED2 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to have no cross-reactivity to ZBED1 or ZBED3. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
Schlagworte: | Anti-YPEL1, Anti-FKSG3, Anti-Protein yippee-like 1 |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
684,00 €
Artikelnummer: G-PACO31124.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
Schlagworte: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
363,00 €
Artikelnummer: VHPS-10079
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | FKSG3, YPEL1, Protein yippee-like 1 |
Anwendung: | RNA quantification |
43,00 €
Artikelnummer: 375894.100
Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
Schlagworte: | FKSG3, YPEL1, Protein yippee-like 1 |
MW: | 29,6 |
ab 511,00 €
Artikelnummer: G-PACO13280.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt...
Schlagworte: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
491,00 €