Zu "O60688" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZBED2
Artikelnummer: 600-401-GA9
Anti-ZBED2 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to have no cross-reactivity to ZBED1 or ZBED3. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
| Schlagworte: | Anti-YPEL1, Anti-FKSG3, Anti-Protein yippee-like 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
684,00 €
Anti-YPEL1
Artikelnummer: G-PACO31124.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt Consortium]
| Schlagworte: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
YPEL1, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-10079
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FKSG3, YPEL1, Protein yippee-like 1 |
| Anwendung: | RNA quantification |
43,00 €
YPEL1, Recombinant, Human, aa1-119, His-SUMO-Tag (Protein...
Artikelnummer: 375894.100
Source:, Recombinant protein corresponding to aa1-119 from human YPEL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD, AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE, Storage and Stability:...
| Schlagworte: | FKSG3, YPEL1, Protein yippee-like 1 |
| MW: | 29,6 |
ab 511,00 €
Anti-YPEL1
Artikelnummer: G-PACO13280.50
YPEL1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. YPEL1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in epithelioid conversion of fibroblasts. [The UniProt...
| Schlagworte: | Anti-FKSG3, Anti-YPEL1, Anti-Protein yippee-like 1 |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
491,00 €
