Telomerase Reverse Transcriptase, Recombinant, Human, aa281-436, His-tag (TERT)

Telomerase Reverse Transcriptase, Recombinant, Human, aa281-436, His-tag (TERT)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406048.20 20 µg - -

3 - 19 Werktage*

420,00 €
406048.100 100 µg - -

3 - 19 Werktage*

679,00 €
 
Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in... mehr
Produktinformationen "Telomerase Reverse Transcriptase, Recombinant, Human, aa281-436, His-tag (TERT)"
Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis. Source: Recombinant protein corresponding to aa281-436 from human Telomerase Reverse Transcriptase, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.7kD, AA Sequence: EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: TP2, EST2, TERT, HEST2, Telomerase catalytic subunit, Telomerase-associated protein 2, Telomerase reverse transcriptase
Hersteller: United States Biological
Hersteller-Nr: 406048

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 22.7 kD
Reinheit: ~85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Telomerase Reverse Transcriptase, Recombinant, Human, aa281-436, His-tag (TERT)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen