QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein

QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374963.20 20 µg - -

3 - 19 Werktage*

511,00 €
374963.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Responsible for the biosynthesis of pyroglutamyl peptides.||Source:|Recombinant protein... mehr
Produktinformationen "QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein"
Responsible for the biosynthesis of pyroglutamyl peptides. Source: Recombinant protein corresponding to aa212-382 from human QPCTL, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD, AA Sequence: AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: gQC, QPCTL, isoQC, EC=2.3.2.5, Glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase
Hersteller: United States Biological
Hersteller-Nr: 374963

Eigenschaften

Konjugat: No
MW: 35,5
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen