Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
298445.50 | 50 µg | - | - |
3 - 19 Werktage* |
985,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10... mehr
Produktinformationen "PD-L1, Recombinant, Human, aa19-239, FLAG-tag (CD274, Programmed Cell Death 1 Ligand 1, CD274 and B7"
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Source: Recombinant protein corresponding to aa19-239 from human PD-L1, fused to FLAG-tag at C-terminal, expressed in HEK293 cell expression system. Molecular Weight: ~26kD, protein runs at a higher MW by SDS-PAGE due to glycosylation, AA Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ, HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY, NKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFN, VTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTDYKDDDDK, Applications: Suitable for use in studying protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: | B7H1, CD274, B7-H1, PD-L1, B7 homolog 1, PDCD1 ligand 1, Programmed death ligand 1, Programmed cell death 1 ligand 1 |
Hersteller: | United States Biological |
Hersteller-Nr: | 298445 |
Eigenschaften
Konjugat: | No |
MW: | 26 |
Format: | Highly Purified |
Datenbank Information
KEGG ID : | K06745 | Passende Produkte |
UniProt ID : | Q9NZQ7 | Passende Produkte |
Gene ID | GeneID 29126 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -80°C |
Versand: | -80°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PD-L1, Recombinant, Human, aa19-239, FLAG-tag (CD274, Programmed Cell Death 1 Ligand 1, CD274 and B7"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen